Lineage for d2l2aa_ (2l2a A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553646Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 1553647Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 1553648Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 1553675Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 1553696Species Human (Homo sapiens) [TaxId:9606] [63822] (5 PDB entries)
  8. 1553703Domain d2l2aa_: 2l2a A: [242742]
    automated match to d1gqba_

Details for d2l2aa_

PDB Entry: 2l2a (more details)

PDB Description: Mutated Domain 11 of the Cytoplasmic region of the Cation-independent mannose-6-phosphate receptor
PDB Compounds: (A:) Insulin-like growth factor 2 receptor variant

SCOPe Domain Sequences for d2l2aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l2aa_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
mksnehddcqvtnpstghlfdlsslsgragftaaysksgvvymsicgenencppgvgacf
gqtrisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmli
sldkqtctlffswhtplacepe

SCOPe Domain Coordinates for d2l2aa_:

Click to download the PDB-style file with coordinates for d2l2aa_.
(The format of our PDB-style files is described here.)

Timeline for d2l2aa_: