Lineage for d2l29b_ (2l29 B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634416Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 2634417Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 2634418Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 2634641Protein Insulin-like growth factor [57002] (1 species)
  7. 2634642Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 2634657Domain d2l29b_: 2l29 B: [242741]
    Other proteins in same PDB: d2l29a1, d2l29a2
    automated match to d1igla_
    mutant

Details for d2l29b_

PDB Entry: 2l29 (more details)

PDB Description: complex structure of e4 mutant human igf2r domain 11 bound to igf-ii
PDB Compounds: (B:) insulin-like growth factor II

SCOPe Domain Sequences for d2l29b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l29b_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse

SCOPe Domain Coordinates for d2l29b_:

Click to download the PDB-style file with coordinates for d2l29b_.
(The format of our PDB-style files is described here.)

Timeline for d2l29b_: