SCOPe 2.07: Domain d2l29b_: 2l29 B:

Lineage for d2l29b_ (2l29 B:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.1: Insulin-like [56993] (1 superfamily)
   nearly all-alpha
   can be classified as disulfide-rich

4. Superfamily g.1.1: Insulin-like [56994] (1 family)

5. Family g.1.1.1: Insulin-like [56995] (5 proteins)

6. Protein Insulin-like growth factor [57002] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
   Uniprot P05019 49-110

8. Domain d2l29b_: 2l29 B: [242741]
   Other proteins in same PDB: d2l29a1, d2l29a2
   automated match to d1igla_
   mutant

Details for d2l29b_

PDB Entry: 2l29

PDB Description: complex structure of e4 mutant human igf2r domain 11 bound to igf-ii

PDB Compounds: (B:) insulin-like growth factor II

SCOPe Domain Sequences for d2l29b_:

Sequence; same for both SEQRES and ATOM records:

>d2l29b_ g.1.1.1 (B:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse

Timeline for d2l29b_:

• d2l29b_ first appeared in SCOPe 2.04
  
• d2l29b_ appears in SCOPe 2.06
  
• d2l29b_ appears in the current release, SCOPe 2.08