Lineage for d2sli_1 (2sli 81-276)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12806Family b.29.1.9: Leech intramolecular trans-sialidase, N-terminal domain [49968] (1 protein)
  6. 12807Protein Leech intramolecular trans-sialidase, N-terminal domain [49969] (1 species)
  7. 12808Species North american leech (Macrobdella decora) [TaxId:6405] [49970] (5 PDB entries)
  8. 12809Domain d2sli_1: 2sli 81-276 [24274]
    Other proteins in same PDB: d2sli_2

Details for d2sli_1

PDB Entry: 2sli (more details), 1.8 Å

PDB Description: leech intramolecular trans-sialidase complexed with 2,7-anhydro-neu5ac, the reaction product

SCOP Domain Sequences for d2sli_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sli_1 b.29.1.9 (81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora)}
ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
alsdeeliqatgvtty

SCOP Domain Coordinates for d2sli_1:

Click to download the PDB-style file with coordinates for d2sli_1.
(The format of our PDB-style files is described here.)

Timeline for d2sli_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2sli_2