SCOPe 2.07: Domain d2l21a1: 2l21 A:1885-2030

Lineage for d2l21a1 (2l21 A:1885-2030)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
   barrel, partly open; n*=8, S*=10; one psi loop

4. Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family)

5. Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)

6. Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [255396] (1 PDB entry)

8. Domain d2l21a1: 2l21 A:1885-2030 [242738]
   Other proteins in same PDB: d2l21a2
   automated match to d1e6fb_

Details for d2l21a1

PDB Entry: 2l21

PDB Description: chicken igf2r domain 11

PDB Compounds: (A:) cation-independent mannose-6-phosphate receptor

SCOPe Domain Sequences for d2l21a1:

Sequence; same for both SEQRES and ATOM records:

>d2l21a1 b.64.1.1 (A:1885-2030) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Chicken (Gallus gallus) [TaxId: 9031]}
mksnvqndcrvtnpatghlfdltslkresgytitdshnrkielnvcaeaksscangaavc
itdgpktlnagklsktltyedqvlklvyedgdpcptdlkmkhksyfsfvcksdagddsqp
vflsfdeqtctsyfswhtslaceeev

Timeline for d2l21a1:

• d2l21a1 first appeared in SCOPe 2.04, called d2l21a_
  
• d2l21a1 appears in SCOPe 2.06
  
• d2l21a1 appears in the current release, SCOPe 2.08