Lineage for d2l1ga_ (2l1g A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705677Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 1705678Protein automated matches [190463] (6 species)
    not a true protein
  7. 1705710Species Human (Homo sapiens) [TaxId:9606] [187379] (9 PDB entries)
  8. 1705736Domain d2l1ga_: 2l1g A: [242734]
    automated match to d2d8ra1
    protein/DNA complex; complexed with zn

Details for d2l1ga_

PDB Entry: 2l1g (more details)

PDB Description: RDC refined solution structure of the THAP zinc finger of THAP1 in complex with its 16bp RRM1 DNA target
PDB Compounds: (A:) THAP domain-containing protein 1

SCOPe Domain Sequences for d2l1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l1ga_ g.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvqscsaygcknrydkdkpvsfhkfpltrpslckeweaavrrknfkptkyssicsehftp
dsfkresnnkllkenavptiflelvpr

SCOPe Domain Coordinates for d2l1ga_:

Click to download the PDB-style file with coordinates for d2l1ga_.
(The format of our PDB-style files is described here.)

Timeline for d2l1ga_: