SCOPe 2.07: Domain d2l1ga1: 2l1g A:1-82

Lineage for d2l1ga1 (2l1g A:1-82)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.0: automated matches [191378] (1 protein)
   not a true family

6. Protein automated matches [190463] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187379] (11 PDB entries)

8. Domain d2l1ga1: 2l1g A:1-82 [242734]
   Other proteins in same PDB: d2l1ga2
   automated match to d2d8ra1
   protein/DNA complex; complexed with zn

Details for d2l1ga1

PDB Entry: 2l1g

PDB Description: RDC refined solution structure of the THAP zinc finger of THAP1 in complex with its 16bp RRM1 DNA target

PDB Compounds: (A:) THAP domain-containing protein 1

SCOPe Domain Sequences for d2l1ga1:

Sequence; same for both SEQRES and ATOM records:

>d2l1ga1 g.39.1.0 (A:1-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvqscsaygcknrydkdkpvsfhkfpltrpslckeweaavrrknfkptkyssicsehftp
dsfkresnnkllkenavptifl

Timeline for d2l1ga1:

• d2l1ga1 first appeared in SCOPe 2.04, called d2l1ga_
  
• d2l1ga1 appears in SCOPe 2.06