SCOP 1.69: Domain d1kit_2: 1kit 347-543

Lineage for d1kit_2 (1kit 347-543)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families)

5. Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)

6. Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (1 species)
   both domains have this fold
   rest of protein is beta-propeller of six sheets

7. Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries)

8. Domain d1kit_2: 1kit 347-543 [24273]
   Other proteins in same PDB: d1kit_3

Details for d1kit_2

PDB Entry: 1kit, 2.3 Å

PDB Description: vibrio cholerae neuraminidase

SCOP Domain Sequences for d1kit_2:

Sequence; same for both SEQRES and ATOM records:

>d1kit_2 b.29.1.8 (347-543) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae}
dvtdqvkersfqiagwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyv
vtlsidesgglvanlngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittw
agevsqenniqfgnadaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklg
wtkiktgntmslygnas

Timeline for d1kit_2:

• d1kit_2 first appeared (with stable ids) in SCOP 1.55
  
• d1kit_2 appears in SCOP 1.67
  
• d1kit_2 appears in SCOP 1.71
  
• d1kit_2 appears in the current release, SCOPe 2.08, called d1kita2