Lineage for d1kit_2 (1kit 347-543)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371771Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)
  6. 371772Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (1 species)
    both domains have this fold
    rest of protein is beta-propeller of six sheets
  7. 371773Species Vibrio cholerae [TaxId:666] [49967] (1 PDB entry)
  8. 371775Domain d1kit_2: 1kit 347-543 [24273]
    Other proteins in same PDB: d1kit_3
    complexed with ca

Details for d1kit_2

PDB Entry: 1kit (more details), 2.3 Å

PDB Description: vibrio cholerae neuraminidase

SCOP Domain Sequences for d1kit_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kit_2 b.29.1.8 (347-543) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae}
dvtdqvkersfqiagwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyv
vtlsidesgglvanlngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittw
agevsqenniqfgnadaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklg
wtkiktgntmslygnas

SCOP Domain Coordinates for d1kit_2:

Click to download the PDB-style file with coordinates for d1kit_2.
(The format of our PDB-style files is described here.)

Timeline for d1kit_2: