Lineage for d1kit_2 (1kit 347-543)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein) Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (1 species) Species Vibrio cholerae [TaxId:666] [49967] (1 PDB entry) 
Domain d1kit_2: 1kit 347-543 [24273]
Other proteins in same PDB: d1kit_3
Details for d1kit_2
PDB Entry: 1kit (more details), 2.3 Å
PDB Description: vibrio cholerae neuraminidase
SCOP Domain Sequences for d1kit_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kit_2 b.29.1.8 (347-543) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae}
dvtdqvkersfqiagwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyv
vtlsidesgglvanlngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittw
agevsqenniqfgnadaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklg
wtkiktgntmslygnas
SCOP Domain Coordinates for d1kit_2:
Click to download the PDB-style file with coordinates for d1kit_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kit_2:
- d1kit_2 first appeared (with stable ids) in SCOP 1.55
- d1kit_2 appears in SCOP 1.59
- d1kit_2 appears in the current release, SCOPe 2.08, called d1kita2
View in 3D
