SCOPe 2.05: Domain d2l0xa_: 2l0x A:

Lineage for d2l0xa_ (2l0x A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTP-binding protein RheB [142275] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255395] (1 PDB entry)

8. Domain d2l0xa_: 2l0x A: [242729]
   automated match to d3t5ga_
   complexed with gdp, mg

Details for d2l0xa_

PDB Entry: 2l0x

PDB Description: Solution structure of the 21 kDa GTPase RHEB bound to GDP

PDB Compounds: (A:) GTP-binding protein Rheb

SCOPe Domain Sequences for d2l0xa_:

Sequence; same for both SEQRES and ATOM records:

>d2l0xa_ c.37.1.8 (A:) GTP-binding protein RheB {Norway rat (Rattus norvegicus) [TaxId: 10116]}
srkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdtagqd
eysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkdlhm
ervisyeegkalaeswnaaflessakenqtavdvfrriileaekidgaa

Timeline for d2l0xa_:

• d2l0xa_ first appeared in SCOPe 2.04
  
• d2l0xa_ appears in SCOPe 2.06
  
• d2l0xa_ appears in the current release, SCOPe 2.08