Lineage for d2l0xa_ (2l0x A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867227Protein GTP-binding protein RheB [142275] (2 species)
  7. 2867252Species Norway rat (Rattus norvegicus) [TaxId:10116] [255395] (1 PDB entry)
  8. 2867253Domain d2l0xa_: 2l0x A: [242729]
    automated match to d3t5ga_
    complexed with gdp, mg

Details for d2l0xa_

PDB Entry: 2l0x (more details)

PDB Description: Solution structure of the 21 kDa GTPase RHEB bound to GDP
PDB Compounds: (A:) GTP-binding protein Rheb

SCOPe Domain Sequences for d2l0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l0xa_ c.37.1.8 (A:) GTP-binding protein RheB {Norway rat (Rattus norvegicus) [TaxId: 10116]}
srkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdtagqd
eysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkdlhm
ervisyeegkalaeswnaaflessakenqtavdvfrriileaekidgaa

SCOPe Domain Coordinates for d2l0xa_:

Click to download the PDB-style file with coordinates for d2l0xa_.
(The format of our PDB-style files is described here.)

Timeline for d2l0xa_: