Lineage for d2l0tb_ (2l0t B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501700Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 1501783Family a.118.9.0: automated matches [191620] (1 protein)
    not a true family
  6. 1501784Protein automated matches [191137] (2 species)
    not a true protein
  7. 1501785Species Human (Homo sapiens) [TaxId:9606] [189251] (6 PDB entries)
  8. 1501790Domain d2l0tb_: 2l0t B: [242727]
    Other proteins in same PDB: d2l0ta_
    automated match to d1elka_

Details for d2l0tb_

PDB Entry: 2l0t (more details)

PDB Description: Solution structure of the complex of ubiquitin and the VHS domain of Stam2
PDB Compounds: (B:) Signal transducing adapter molecule 2

SCOPe Domain Sequences for d2l0tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l0tb_ a.118.9.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgmplftanpfeqdvekatneynttedwslimdicdkvgstpngakdclkaimkr
vnhkvphvalqaltllgacvancgkifhlevcsrdfatevraviknkahpkvceklkslm
vewseefqkdpqfslisatiksmkeegitfppagsqtsgpssg

SCOPe Domain Coordinates for d2l0tb_:

Click to download the PDB-style file with coordinates for d2l0tb_.
(The format of our PDB-style files is described here.)

Timeline for d2l0tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2l0ta_