SCOPe 2.08: Domain d2l0tb1: 2l0t B:8-157

Lineage for d2l0tb1 (2l0t B:8-157)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.0: automated matches [191620] (1 protein)
   not a true family

6. Protein automated matches [191137] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189251] (7 PDB entries)

8. Domain d2l0tb1: 2l0t B:8-157 [242727]
   Other proteins in same PDB: d2l0ta_, d2l0tb2, d2l0tb3
   automated match to d1elka_

Details for d2l0tb1

PDB Entry: 2l0t

PDB Description: Solution structure of the complex of ubiquitin and the VHS domain of Stam2

PDB Compounds: (B:) Signal transducing adapter molecule 2

SCOPe Domain Sequences for d2l0tb1:

Sequence; same for both SEQRES and ATOM records:

>d2l0tb1 a.118.9.0 (B:8-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mplftanpfeqdvekatneynttedwslimdicdkvgstpngakdclkaimkrvnhkvph
valqaltllgacvancgkifhlevcsrdfatevraviknkahpkvceklkslmvewseef
qkdpqfslisatiksmkeegitfppagsqt

Timeline for d2l0tb1:

• d2l0tb1 first appeared in SCOPe 2.04, called d2l0tb_
  
• d2l0tb1 appears in SCOPe 2.07