![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein automated matches [190286] (9 species) not a true protein |
![]() | Species Vibrio harveyi [TaxId:673519] [255394] (1 PDB entry) |
![]() | Domain d2l0qa1: 2l0q A:5-80 [242724] Other proteins in same PDB: d2l0qa2 automated match to d3ejbc_ |
PDB Entry: 2l0q (more details)
SCOPe Domain Sequences for d2l0qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l0qa1 a.28.1.1 (A:5-80) automated matches {Vibrio harveyi [TaxId: 673519]} snieervkkiiveqlgvdeaevkneasfvddlgadsldtvelvmaleeefdteipdeeae kittvqaaidyvnshq
Timeline for d2l0qa1: