Lineage for d2l0qa1 (2l0q A:5-80)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706187Protein automated matches [190286] (9 species)
    not a true protein
  7. 2706226Species Vibrio harveyi [TaxId:673519] [255394] (1 PDB entry)
  8. 2706227Domain d2l0qa1: 2l0q A:5-80 [242724]
    Other proteins in same PDB: d2l0qa2
    automated match to d3ejbc_

Details for d2l0qa1

PDB Entry: 2l0q (more details)

PDB Description: NMR Solution Structure of Vibrio harveyi Acyl Carrier Protein (ACP)
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2l0qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l0qa1 a.28.1.1 (A:5-80) automated matches {Vibrio harveyi [TaxId: 673519]}
snieervkkiiveqlgvdeaevkneasfvddlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyvnshq

SCOPe Domain Coordinates for d2l0qa1:

Click to download the PDB-style file with coordinates for d2l0qa1.
(The format of our PDB-style files is described here.)

Timeline for d2l0qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2l0qa2