SCOPe 2.08: Domain d2l0qa1: 2l0q A:5-80

Lineage for d2l0qa1 (2l0q A:5-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (9 species)
   not a true protein

7. Species Vibrio harveyi [TaxId:673519] [255394] (1 PDB entry)

8. Domain d2l0qa1: 2l0q A:5-80 [242724]
   Other proteins in same PDB: d2l0qa2
   automated match to d3ejbc_

Details for d2l0qa1

PDB Entry: 2l0q

PDB Description: NMR Solution Structure of Vibrio harveyi Acyl Carrier Protein (ACP)

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2l0qa1:

Sequence; same for both SEQRES and ATOM records:

>d2l0qa1 a.28.1.1 (A:5-80) automated matches {Vibrio harveyi [TaxId: 673519]}
snieervkkiiveqlgvdeaevkneasfvddlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyvnshq

Timeline for d2l0qa1:

• d2l0qa1 first appeared in SCOPe 2.04, called d2l0qa_
  
• d2l0qa1 appears in SCOPe 2.07