SCOPe 2.08: Domain d2l0pb_: 2l0p B:

Lineage for d2l0pb_ (2l0p B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)

8. Domain d2l0pb_: 2l0p B: [242723]
   automated match to d1k2ha_

Details for d2l0pb_

PDB Entry: 2l0p

PDB Description: solution structure of human apo-s100a1 protein by nmr spectroscopy

PDB Compounds: (B:) S100 calcium binding protein A1

SCOPe Domain Sequences for d2l0pb_:

Sequence; same for both SEQRES and ATOM records:

>d2l0pb_ a.39.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
ldengdgevdfqeyvvlvaaltvacnnffwens

Timeline for d2l0pb_:

• d2l0pb_ first appeared in SCOPe 2.04
  
• d2l0pb_ appears in SCOPe 2.07