SCOPe 2.08: Domain d2l0aa1: 2l0a A:12-72

Lineage for d2l0aa1 (2l0a A:12-72)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d2l0aa1: 2l0a A:12-72 [242720]
   Other proteins in same PDB: d2l0aa2
   automated match to d1sema_

Details for d2l0aa1

PDB Entry: 2l0a

PDB Description: Solution NMR Structure of Signal transducing adapter molecule 1 STAM-1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4479E

PDB Compounds: (A:) Signal transducing adapter molecule 1

SCOPe Domain Sequences for d2l0aa1:

Sequence; same for both SEQRES and ATOM records:

>d2l0aa1 b.34.2.0 (A:12-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhqhearkvraiydfeaaedneltfkageiitvlddsdpnwwkgethqgiglfpsnfvta
d

Timeline for d2l0aa1:

• d2l0aa1 first appeared in SCOPe 2.04, called d2l0aa_
  
• d2l0aa1 appears in SCOPe 2.07