Lineage for d1kit_1 (1kit 25-216)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108950Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)
  6. 108951Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (1 species)
  7. 108952Species Vibrio cholerae [TaxId:666] [49967] (1 PDB entry)
  8. 108953Domain d1kit_1: 1kit 25-216 [24272]
    Other proteins in same PDB: d1kit_3

Details for d1kit_1

PDB Entry: 1kit (more details), 2.3 Å

PDB Description: vibrio cholerae neuraminidase

SCOP Domain Sequences for d1kit_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kit_1 b.29.1.8 (25-216) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae}
alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
ayrdikfeiqgd

SCOP Domain Coordinates for d1kit_1:

Click to download the PDB-style file with coordinates for d1kit_1.
(The format of our PDB-style files is described here.)

Timeline for d1kit_1: