Lineage for d1kita1 (1kit A:25-216)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043544Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)
  6. 2043545Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (2 species)
    both domains have this fold
    rest of protein is beta-propeller of six sheets
  7. 2043546Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries)
    Uniprot P37060
  8. 2043551Domain d1kita1: 1kit A:25-216 [24272]
    Other proteins in same PDB: d1kita3
    complexed with ca

Details for d1kita1

PDB Entry: 1kit (more details), 2.3 Å

PDB Description: vibrio cholerae neuraminidase
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1kita1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kita1 b.29.1.8 (A:25-216) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 666]}
alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
ayrdikfeiqgd

SCOPe Domain Coordinates for d1kita1:

Click to download the PDB-style file with coordinates for d1kita1.
(The format of our PDB-style files is described here.)

Timeline for d1kita1: