![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.4: Smg-4/UPF3 [102987] (2 proteins) Pfam PF03467 |
![]() | Protein automated matches [254592] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255393] (1 PDB entry) |
![]() | Domain d2l08a1: 2l08 A:12-97 [242719] Other proteins in same PDB: d2l08a2 automated match to d1uw4a_ |
PDB Entry: 2l08 (more details)
SCOPe Domain Sequences for d2l08a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l08a1 d.58.7.4 (A:12-97) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvirrlppgltkeqleeqlrplpahdyfeffaadlslyphlysrayinfrnpddillfrd rfdgyifldskgleypavvefapfqk
Timeline for d2l08a1: