Lineage for d2l08a1 (2l08 A:12-97)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952459Family d.58.7.4: Smg-4/UPF3 [102987] (2 proteins)
    Pfam PF03467
  6. 2952464Protein automated matches [254592] (1 species)
    not a true protein
  7. 2952465Species Human (Homo sapiens) [TaxId:9606] [255393] (1 PDB entry)
  8. 2952466Domain d2l08a1: 2l08 A:12-97 [242719]
    Other proteins in same PDB: d2l08a2
    automated match to d1uw4a_

Details for d2l08a1

PDB Entry: 2l08 (more details)

PDB Description: solution nmr structure of nonsense mrna reducing factor 3a from h. sapiens, northeast structural genomics consortium target hr4714b
PDB Compounds: (A:) Regulator of nonsense transcripts 3A

SCOPe Domain Sequences for d2l08a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l08a1 d.58.7.4 (A:12-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvirrlppgltkeqleeqlrplpahdyfeffaadlslyphlysrayinfrnpddillfrd
rfdgyifldskgleypavvefapfqk

SCOPe Domain Coordinates for d2l08a1:

Click to download the PDB-style file with coordinates for d2l08a1.
(The format of our PDB-style files is described here.)

Timeline for d2l08a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2l08a2