SCOPe 2.07: Domain d2l05a1: 2l05 A:149-232

Lineage for d2l05a1 (2l05 A:149-232)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)

8. Domain d2l05a1: 2l05 A:149-232 [242718]
   Other proteins in same PDB: d2l05a2
   automated match to d3ny5b_

Details for d2l05a1

PDB Entry: 2l05

PDB Description: solution nmr structure of the ras-binding domain of serine/threonine- protein kinase b-raf from homo sapiens, northeast structural genomics consortium target hr4694f

PDB Compounds: (A:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d2l05a1:

Sequence; same for both SEQRES and ATOM records:

>d2l05a1 d.15.1.0 (A:149-232) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkspqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpi
gwdtdiswltgeelhvevlenvpl

Timeline for d2l05a1:

• d2l05a1 first appeared in SCOPe 2.04, called d2l05a_
  
• d2l05a1 appears in SCOPe 2.06
  
• d2l05a1 appears in the current release, SCOPe 2.08