Lineage for d2l00b_ (2l00 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931514Protein Ubiquitin [54238] (9 species)
  7. 2931519Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (14 PDB entries)
  8. 2931532Domain d2l00b_: 2l00 B: [242717]
    automated match to d3cmmb_
    complexed with zn

Details for d2l00b_

PDB Entry: 2l00 (more details)

PDB Description: Solution structure of the non-covalent complex of the ZNF216 A20 domain with ubiquitin
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2l00b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l00b_ d.15.1.1 (B:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvl

SCOPe Domain Coordinates for d2l00b_:

Click to download the PDB-style file with coordinates for d2l00b_.
(The format of our PDB-style files is described here.)

Timeline for d2l00b_: