Lineage for d2kztb_ (2kzt B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2010009Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 2010061Protein automated matches [254534] (2 species)
    not a true protein
  7. 2010064Species Mouse (Mus musculus) [TaxId:10090] [255392] (1 PDB entry)
  8. 2010065Domain d2kztb_: 2kzt B: [242716]
    automated match to d2nsza1

Details for d2kztb_

PDB Entry: 2kzt (more details)

PDB Description: Structure of the Tandem MA-3 Region of Pdcd4
PDB Compounds: (B:) Programmed cell death protein 4

SCOPe Domain Sequences for d2kztb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kztb_ a.118.1.14 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ggqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestges
afkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagi
iskqlrdlcps

SCOPe Domain Coordinates for d2kztb_:

Click to download the PDB-style file with coordinates for d2kztb_.
(The format of our PDB-style files is described here.)

Timeline for d2kztb_: