| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
| Protein automated matches [254534] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [255392] (1 PDB entry) |
| Domain d2kztb_: 2kzt B: [242716] automated match to d2nsza1 |
PDB Entry: 2kzt (more details)
SCOPe Domain Sequences for d2kztb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kztb_ a.118.1.14 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ggqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestges
afkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagi
iskqlrdlcps
Timeline for d2kztb_: