Lineage for d2kzia_ (2kzi A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481774Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1481775Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1481776Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1481797Protein automated matches [191290] (4 species)
    not a true protein
  7. 1481803Species Staphylococcus aureus [TaxId:1280] [189943] (10 PDB entries)
  8. 1481813Domain d2kzia_: 2kzi A: [242714]
    automated match to d1h0ta_

Details for d2kzia_

PDB Entry: 2kzi (more details)

PDB Description: Solution structure of the ZHER2 Affibody
PDB Compounds: (A:) Engineered protein, ZHER2 Affibody

SCOPe Domain Sequences for d2kzia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kzia_ a.8.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
vdnkfnkemrnayweiallpnlnnqqkrafirslyddpsqsanllaeakklndaqapk

SCOPe Domain Coordinates for d2kzia_:

Click to download the PDB-style file with coordinates for d2kzia_.
(The format of our PDB-style files is described here.)

Timeline for d2kzia_: