| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) ![]() |
| Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
| Protein automated matches [191290] (5 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [189943] (16 PDB entries) |
| Domain d2kzia_: 2kzi A: [242714] automated match to d1h0ta_ |
PDB Entry: 2kzi (more details)
SCOPe Domain Sequences for d2kzia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kzia_ a.8.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
vdnkfnkemrnayweiallpnlnnqqkrafirslyddpsqsanllaeakklndaqapk
Timeline for d2kzia_: