Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families) possible distant homologue of the type I KH domain lacking the KH motif automatically mapped to Pfam PF02033 |
Family d.52.7.0: automated matches [254257] (1 protein) not a true family |
Protein automated matches [254591] (1 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [255391] (1 PDB entry) |
Domain d2kzfa1: 2kzf A:2-106 [242712] Other proteins in same PDB: d2kzfa2 automated match to d1pa4a_ |
PDB Entry: 2kzf (more details)
SCOPe Domain Sequences for d2kzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kzfa1 d.52.7.0 (A:2-106) automated matches {Thermotoga maritima [TaxId: 2336]} mnpayrkamleseiqkllmealqqlrdprlkkdfvtfsrvelskdkryadvyvsflgtpe erketveilnrakgffrtfiaknlrlyvapeirfyedkgieasvk
Timeline for d2kzfa1: