Lineage for d2kzfa1 (2kzf A:2-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947415Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families) (S)
    possible distant homologue of the type I KH domain lacking the KH motif
    automatically mapped to Pfam PF02033
  5. 2947433Family d.52.7.0: automated matches [254257] (1 protein)
    not a true family
  6. 2947434Protein automated matches [254591] (2 species)
    not a true protein
  7. 2947437Species Thermotoga maritima [TaxId:2336] [255391] (1 PDB entry)
  8. 2947438Domain d2kzfa1: 2kzf A:2-106 [242712]
    Other proteins in same PDB: d2kzfa2
    automated match to d1pa4a_

Details for d2kzfa1

PDB Entry: 2kzf (more details)

PDB Description: Solution NMR structure of the thermotoga maritima protein TM0855 a putative ribosome binding factor A
PDB Compounds: (A:) ribosome-binding factor a

SCOPe Domain Sequences for d2kzfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kzfa1 d.52.7.0 (A:2-106) automated matches {Thermotoga maritima [TaxId: 2336]}
mnpayrkamleseiqkllmealqqlrdprlkkdfvtfsrvelskdkryadvyvsflgtpe
erketveilnrakgffrtfiaknlrlyvapeirfyedkgieasvk

SCOPe Domain Coordinates for d2kzfa1:

Click to download the PDB-style file with coordinates for d2kzfa1.
(The format of our PDB-style files is described here.)

Timeline for d2kzfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kzfa2