SCOPe 2.08: Domain d2kzfa1: 2kzf A:2-106

Lineage for d2kzfa1 (2kzf A:2-106)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families)
   possible distant homologue of the type I KH domain lacking the KH motif
   automatically mapped to Pfam PF02033

5. Family d.52.7.0: automated matches [254257] (1 protein)
   not a true family

6. Protein automated matches [254591] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [255391] (1 PDB entry)

8. Domain d2kzfa1: 2kzf A:2-106 [242712]
   Other proteins in same PDB: d2kzfa2
   automated match to d1pa4a_

Details for d2kzfa1

PDB Entry: 2kzf

PDB Description: Solution NMR structure of the thermotoga maritima protein TM0855 a putative ribosome binding factor A

PDB Compounds: (A:) ribosome-binding factor a

SCOPe Domain Sequences for d2kzfa1:

Sequence; same for both SEQRES and ATOM records:

>d2kzfa1 d.52.7.0 (A:2-106) automated matches {Thermotoga maritima [TaxId: 2336]}
mnpayrkamleseiqkllmealqqlrdprlkkdfvtfsrvelskdkryadvyvsflgtpe
erketveilnrakgffrtfiaknlrlyvapeirfyedkgieasvk

Timeline for d2kzfa1:

• d2kzfa1 first appeared in SCOPe 2.04, called d2kzfa_
  
• d2kzfa1 appears in SCOPe 2.07