Lineage for d2kz2a1 (2kz2 A:76-148)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710643Species Chicken (Gallus gallus) [TaxId:9031] [47520] (10 PDB entries)
    mutant with a two residue deletion in the central helix
  8. 2710654Domain d2kz2a1: 2kz2 A:76-148 [242709]
    Other proteins in same PDB: d2kz2a2
    automated match to d1r2ua_
    complexed with ca; mutant

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2kz2a1

PDB Entry: 2kz2 (more details)

PDB Description: Calmodulin, C-terminal domain, F92E mutant
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2kz2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kz2a1 a.39.1.5 (A:76-148) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]}
mkdtdseeeireafrvedkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
vnyeefvqmmtak

SCOPe Domain Coordinates for d2kz2a1:

Click to download the PDB-style file with coordinates for d2kz2a1.
(The format of our PDB-style files is described here.)

Timeline for d2kz2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kz2a2