| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Calmodulin [47516] (13 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [47520] (10 PDB entries) mutant with a two residue deletion in the central helix |
| Domain d2kz2a1: 2kz2 A:76-148 [242709] Other proteins in same PDB: d2kz2a2 automated match to d1r2ua_ complexed with ca; mutant fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2kz2 (more details)
SCOPe Domain Sequences for d2kz2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kz2a1 a.39.1.5 (A:76-148) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]}
mkdtdseeeireafrvedkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgq
vnyeefvqmmtak
Timeline for d2kz2a1: