| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
| Protein Interferon-alpha 2a [47314] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47315] (9 PDB entries) |
| Domain d2kz1a_: 2kz1 A: [242706] Other proteins in same PDB: d2kz1b1, d2kz1b2 automated match to d1itfa_ |
PDB Entry: 2kz1 (more details)
SCOPe Domain Sequences for d2kz1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kz1a_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske
Timeline for d2kz1a_: