![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries) |
![]() | Domain d2kyxa1: 2kyx A:3-83 [242705] Other proteins in same PDB: d2kyxa2 automated match to d2cqba1 |
PDB Entry: 2kyx (more details)
SCOPe Domain Sequences for d2kyxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kyxa1 d.58.7.1 (A:3-83) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaa aidnmneselfgrtirvnlak
Timeline for d2kyxa1: