Lineage for d2kysa_ (2kys A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481774Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1482011Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) (S)
  5. 1482012Family a.8.9.1: Coronavirus NSP7-like [140368] (2 proteins)
    automatically mapped to Pfam PF08716
  6. 1482017Protein automated matches [190477] (1 species)
    not a true protein
  7. 1482018Species SARS coronavirus [TaxId:227859] [187402] (2 PDB entries)
  8. 1482022Domain d2kysa_: 2kys A: [242704]
    automated match to d1ysya1

Details for d2kysa_

PDB Entry: 2kys (more details)

PDB Description: NMR Structure of the SARS Coronavirus Nonstructural Protein Nsp7 in Solution at pH 6.5
PDB Compounds: (A:) Non-structural protein 7

SCOPe Domain Sequences for d2kysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kysa_ a.8.9.1 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
ghskmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsv
llsmqgavdinrlceemldnratlq

SCOPe Domain Coordinates for d2kysa_:

Click to download the PDB-style file with coordinates for d2kysa_.
(The format of our PDB-style files is described here.)

Timeline for d2kysa_: