Lineage for d2kysa1 (2kys A:3-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697307Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) (S)
  5. 2697308Family a.8.9.1: Coronavirus NSP7-like [140368] (2 proteins)
    automatically mapped to Pfam PF08716
  6. 2697313Protein automated matches [190477] (1 species)
    not a true protein
  7. 2697314Species SARS coronavirus [TaxId:227859] [187402] (2 PDB entries)
  8. 2697318Domain d2kysa1: 2kys A:3-85 [242704]
    Other proteins in same PDB: d2kysa2
    automated match to d1ysya1

Details for d2kysa1

PDB Entry: 2kys (more details)

PDB Description: nmr structure of the sars coronavirus nonstructural protein nsp7 in solution at ph 6.5
PDB Compounds: (A:) Non-structural protein 7

SCOPe Domain Sequences for d2kysa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kysa1 a.8.9.1 (A:3-85) automated matches {SARS coronavirus [TaxId: 227859]}
skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll
smqgavdinrlceemldnratlq

SCOPe Domain Coordinates for d2kysa1:

Click to download the PDB-style file with coordinates for d2kysa1.
(The format of our PDB-style files is described here.)

Timeline for d2kysa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kysa2