| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) ![]() |
| Family c.44.2.0: automated matches [254256] (1 protein) not a true family |
| Protein automated matches [254590] (4 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255390] (1 PDB entry) |
| Domain d2kyra_: 2kyr A: [242703] automated match to d2r4qa1 |
PDB Entry: 2kyr (more details)
SCOPe Domain Sequences for d2kyra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kyra_ c.44.2.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mskklialcacpmglahtfmaaqaleeaaveagyevkietqgadgiqnrltaqdiaeati
iihsvavtpednerfesrdvyeitlqdaiknaagiikeieemiaseqq
Timeline for d2kyra_: