Lineage for d2kyra_ (2kyr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874992Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 2875014Family c.44.2.0: automated matches [254256] (1 protein)
    not a true family
  6. 2875015Protein automated matches [254590] (4 species)
    not a true protein
  7. 2875021Species Escherichia coli K-12 [TaxId:83333] [255390] (1 PDB entry)
  8. 2875022Domain d2kyra_: 2kyr A: [242703]
    automated match to d2r4qa1

Details for d2kyra_

PDB Entry: 2kyr (more details)

PDB Description: solution structure of enzyme iib subunit of pts system from escherichia coli k12. northeast structural genomics consortium target er315/ontario center for structural proteomics target ec0544
PDB Compounds: (A:) Fructose-like phosphotransferase enzyme IIB component 1

SCOPe Domain Sequences for d2kyra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kyra_ c.44.2.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mskklialcacpmglahtfmaaqaleeaaveagyevkietqgadgiqnrltaqdiaeati
iihsvavtpednerfesrdvyeitlqdaiknaagiikeieemiaseqq

SCOPe Domain Coordinates for d2kyra_:

Click to download the PDB-style file with coordinates for d2kyra_.
(The format of our PDB-style files is described here.)

Timeline for d2kyra_: