Lineage for d2kyka1 (2kyk A:6-39)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420693Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2420694Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2420695Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2420791Protein automated matches [192459] (3 species)
    not a true protein
  7. 2420794Species Human (Homo sapiens) [TaxId:9606] [161325] (20 PDB entries)
  8. 2420813Domain d2kyka1: 2kyk A:6-39 [242701]
    Other proteins in same PDB: d2kyka2
    automated match to d1i5hw_

Details for d2kyka1

PDB Entry: 2kyk (more details)

PDB Description: The sandwich region between two LMP2A PY motif regulates the interaction between AIP4WW2domain and PY motif
PDB Compounds: (A:) E3 ubiquitin-protein ligase Itchy homolog

SCOPe Domain Sequences for d2kyka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kyka1 b.72.1.1 (A:6-39) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plppgwerrvdnmgriyyvdhftrtttwqrptle

SCOPe Domain Coordinates for d2kyka1:

Click to download the PDB-style file with coordinates for d2kyka1.
(The format of our PDB-style files is described here.)

Timeline for d2kyka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kyka2