SCOPe 2.08: Domain d2kyka1: 2kyk A:6-39

Lineage for d2kyka1 (2kyk A:6-39)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein automated matches [192459] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [161325] (20 PDB entries)

8. Domain d2kyka1: 2kyk A:6-39 [242701]
   Other proteins in same PDB: d2kyka2
   automated match to d1i5hw_

Details for d2kyka1

PDB Entry: 2kyk

PDB Description: The sandwich region between two LMP2A PY motif regulates the interaction between AIP4WW2domain and PY motif

PDB Compounds: (A:) E3 ubiquitin-protein ligase Itchy homolog

SCOPe Domain Sequences for d2kyka1:

Sequence; same for both SEQRES and ATOM records:

>d2kyka1 b.72.1.1 (A:6-39) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plppgwerrvdnmgriyyvdhftrtttwqrptle

Timeline for d2kyka1:

• d2kyka1 first appeared in SCOPe 2.04, called d2kyka_
  
• d2kyka1 appears in SCOPe 2.07