Lineage for d2kyca_ (2kyc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323645Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 2323706Protein automated matches [254433] (4 species)
    not a true protein
  7. 2323707Species Chicken (Gallus gallus) [TaxId:9031] [255387] (2 PDB entries)
  8. 2323709Domain d2kyca_: 2kyc A: [242696]
    automated match to d1rroa_

Details for d2kyca_

PDB Entry: 2kyc (more details)

PDB Description: solution structure of ca-free chicken parvalbumin 3 (cpv3)
PDB Compounds: (A:) Parvalbumin, thymic CPV3

SCOPe Domain Sequences for d2kyca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kyca_ a.39.1.4 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
sltdilspsdiaaalrdcqapdsfspkkffqisgmskksssqlkeifrildndqsgfiee
delkyflqrfesgarvltasetktflaaadhdgdgkigaeefqemvqs

SCOPe Domain Coordinates for d2kyca_:

Click to download the PDB-style file with coordinates for d2kyca_.
(The format of our PDB-style files is described here.)

Timeline for d2kyca_: