| Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
| Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily) 3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha |
Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families) ![]() |
| Family e.43.1.2: Capz beta-1 subunit [90100] (2 proteins) automatically mapped to Pfam PF01115 |
| Protein Capz beta-1 subunit [90101] (1 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [90102] (8 PDB entries) |
| Domain d2kxpb_: 2kxp B: [242693] Other proteins in same PDB: d2kxpa_, d2kxpc_ automated match to d1iznb_ |
PDB Entry: 2kxp (more details)
SCOPe Domain Sequences for d2kxpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kxpb_ e.43.1.2 (B:) Capz beta-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
sdqqldcaldlmrrlppqqieknlsdlidlvpslcedllssvdqplkiardkvvgkdyll
cdynrdgdsyrspwsnkydppledgampsarlrkleveannafdqyrdlyfeggvssvyl
wdldhgfagvilikkagdgskkikgcwdsihvvevqekssgrtahykltstvmlwlqtnk
tgsgtmnlggsltrqmekdetvsdssphianigrlvedmenkirstlneiyfgktkdivn
glrsidaipdnqkykqlqrelsqvltqrqi
Timeline for d2kxpb_: