SCOPe 2.07: Domain d2kxpb_: 2kxp B:

Lineage for d2kxpb_ (2kxp B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily)
   3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha

4. Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families)

5. Family e.43.1.2: Capz beta-1 subunit [90100] (2 proteins)
   automatically mapped to Pfam PF01115

6. Protein Capz beta-1 subunit [90101] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [90102] (8 PDB entries)

8. Domain d2kxpb_: 2kxp B: [242693]
   Other proteins in same PDB: d2kxpa_, d2kxpc_
   automated match to d1iznb_

Details for d2kxpb_

PDB Entry: 2kxp

PDB Description: Solution NMR structure of V-1 bound to capping protein (CP)

PDB Compounds: (B:) F-actin-capping protein subunit beta isoforms 1 and 2

SCOPe Domain Sequences for d2kxpb_:

Sequence; same for both SEQRES and ATOM records:

>d2kxpb_ e.43.1.2 (B:) Capz beta-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
sdqqldcaldlmrrlppqqieknlsdlidlvpslcedllssvdqplkiardkvvgkdyll
cdynrdgdsyrspwsnkydppledgampsarlrkleveannafdqyrdlyfeggvssvyl
wdldhgfagvilikkagdgskkikgcwdsihvvevqekssgrtahykltstvmlwlqtnk
tgsgtmnlggsltrqmekdetvsdssphianigrlvedmenkirstlneiyfgktkdivn
glrsidaipdnqkykqlqrelsqvltqrqi

Timeline for d2kxpb_:

• d2kxpb_ first appeared in SCOPe 2.04
  
• d2kxpb_ appears in SCOPe 2.06
  
• d2kxpb_ appears in the current release, SCOPe 2.08