SCOPe 2.06: Domain d2kxpa_: 2kxp A:

Lineage for d2kxpa_ (2kxp A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.43: Subunits of heterodimeric actin filament capping protein Capz [90095] (1 superfamily)
   3 domains: (1) protozoan pheromone-like alpha-helical bundle; (2) rubredoxin-like domain lacking metal-binding site; (3) alpha+beta heterodimerisation domain: alpha-beta(5)-alpha

4. Superfamily e.43.1: Subunits of heterodimeric actin filament capping protein Capz [90096] (3 families)

5. Family e.43.1.1: Capz alpha-1 subunit [90097] (1 protein)
   automatically mapped to Pfam PF01267

6. Protein Capz alpha-1 subunit [90098] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [90099] (10 PDB entries)

8. Domain d2kxpa_: 2kxp A: [242692]
   Other proteins in same PDB: d2kxpb_, d2kxpc_
   automated match to d1izna_

Details for d2kxpa_

PDB Entry: 2kxp

PDB Description: Solution NMR structure of V-1 bound to capping protein (CP)

PDB Compounds: (A:) F-actin-capping protein subunit alpha-1

SCOPe Domain Sequences for d2kxpa_:

Sequence; same for both SEQRES and ATOM records:

>d2kxpa_ e.43.1.1 (A:) Capz alpha-1 subunit {Chicken (Gallus gallus) [TaxId: 9031]}
rvsdeekvriaakfithappgefnevfndvrlllnndnllregaahafaqynmdqftpvk
iegyddqvlitehgdlgngrfldprnkisfkfdhlrkeasdpqpedtesalkqwrdacds
alrayvkdhypngfctvygksidgqqtiiacieshqfqpknfwngrwrsewkftitppta
qvaavlkiqvhyyedgnvqlvshkdiqdsvqvssdvqtakefikiienaeneyqtaisen
yqtmsdttfkalrrqlpvtrtkidwnkilsykigk

Timeline for d2kxpa_:

• d2kxpa_ first appeared in SCOPe 2.04
  
• d2kxpa_ appears in SCOPe 2.05
  
• d2kxpa_ appears in SCOPe 2.07
  
• d2kxpa_ appears in the current release, SCOPe 2.08