Lineage for d2kxla_ (2kxl A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1558339Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1559475Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 1559481Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 1559622Protein automated matches [190352] (8 species)
    not a true protein
  7. 1559658Species Mesorhizobium loti [TaxId:381] [188511] (2 PDB entries)
  8. 1559663Domain d2kxla_: 2kxl A: [242690]
    automated match to d1vp6a_

Details for d2kxla_

PDB Entry: 2kxl (more details)

PDB Description: Solution structure of a bacterial cyclic nucleotide-activated K+ channel binding domain in the unliganded state
PDB Compounds: (A:) Cyclic nucleotide-gated potassium channel mll3241

SCOPe Domain Sequences for d2kxla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kxla_ b.82.3.2 (A:) automated matches {Mesorhizobium loti [TaxId: 381]}
gsqevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmf
fvvegsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcss
speiaeifrktalerrgaaasa

SCOPe Domain Coordinates for d2kxla_:

Click to download the PDB-style file with coordinates for d2kxla_.
(The format of our PDB-style files is described here.)

Timeline for d2kxla_: