Lineage for d1epwa1 (1epw A:862-1079)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 227020Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 227021Protein Botulinum neurotoxin [49959] (2 species)
  7. 227024Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (7 PDB entries)
  8. 227025Domain d1epwa1: 1epw A:862-1079 [24269]
    Other proteins in same PDB: d1epwa2, d1epwa3, d1epwa4
    complexed with so4, zn

Details for d1epwa1

PDB Entry: 1epw (more details), 1.9 Å

PDB Description: crystal structure of clostridium neurotoxin type b

SCOP Domain Sequences for d1epwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

SCOP Domain Coordinates for d1epwa1:

Click to download the PDB-style file with coordinates for d1epwa1.
(The format of our PDB-style files is described here.)

Timeline for d1epwa1: