SCOPe 2.05: Domain d2kx4a_: 2kx4 A:

Lineage for d2kx4a_ (2kx4 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (3 families)

5. Family b.106.1.2: gpFII-like [74966] (2 proteins)
   similar to the N-terminal barrel of T4 gp27
   automatically mapped to Pfam PF13856

6. Protein Tail attachment protein gpF3 [74967] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [74968] (2 PDB entries)

8. Domain d2kx4a_: 2kx4 A: [242687]
   automated match to d1k0ha_

Details for d2kx4a_

PDB Entry: 2kx4

PDB Description: Solution structure of Bacteriophage Lambda gpFII

PDB Compounds: (A:) Tail attachment protein

SCOPe Domain Sequences for d2kx4a_:

Sequence; same for both SEQRES and ATOM records:

>d2kx4a_ b.106.1.2 (A:) Tail attachment protein gpF3 {Bacteriophage lambda [TaxId: 10710]}
madfdnlfdaaiaradetirgymgtsatitsgeqsgavirgvfddpenisyagqgvrveg
sspslfvrtdevrqlrrgdtltigeenfwvdrvspddggschlwlgrgvppavnrrr

Timeline for d2kx4a_:

• d2kx4a_ first appeared in SCOPe 2.04
  
• d2kx4a_ appears in SCOPe 2.06
  
• d2kx4a_ appears in the current release, SCOPe 2.08