SCOPe 2.07: Domain d2kwla1: 2kwl A:5-84

Lineage for d2kwla1 (2kwl A:5-84)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (28 species)
   not a true protein

7. Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [255384] (1 PDB entry)

8. Domain d2kwla1: 2kwl A:5-84 [242683]
   Other proteins in same PDB: d2kwla2
   automated match to d1x3oa_

Details for d2kwla1

PDB Entry: 2kwl

PDB Description: Solution Structure of acyl carrier protein from Borrelia burgdorferi

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2kwla1:

Sequence; same for both SEQRES and ATOM records:

>d2kwla1 a.28.1.0 (A:5-84) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
mdndeifskvrsiiseqldkkedeittdsrfvedlnadsldiyellylleeafddkipen
eanefetvgdvvnfikkrkg

Timeline for d2kwla1:

• d2kwla1 first appeared in SCOPe 2.04, called d2kwla_
  
• d2kwla1 appears in SCOPe 2.06
  
• d2kwla1 appears in the current release, SCOPe 2.08