![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
![]() | Protein automated matches [191038] (28 species) not a true protein |
![]() | Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [255384] (1 PDB entry) |
![]() | Domain d2kwla1: 2kwl A:5-84 [242683] Other proteins in same PDB: d2kwla2 automated match to d1x3oa_ |
PDB Entry: 2kwl (more details)
SCOPe Domain Sequences for d2kwla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kwla1 a.28.1.0 (A:5-84) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} mdndeifskvrsiiseqldkkedeittdsrfvedlnadsldiyellylleeafddkipen eanefetvgdvvnfikkrkg
Timeline for d2kwla1: