Lineage for d2kwla_ (2kwl A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487378Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1487491Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 1487492Protein automated matches [191038] (14 species)
    not a true protein
  7. 1487502Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [255384] (1 PDB entry)
  8. 1487503Domain d2kwla_: 2kwl A: [242683]
    automated match to d1x3oa_

Details for d2kwla_

PDB Entry: 2kwl (more details)

PDB Description: Solution Structure of acyl carrier protein from Borrelia burgdorferi
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2kwla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kwla_ a.28.1.0 (A:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
gpgsmdndeifskvrsiiseqldkkedeittdsrfvedlnadsldiyellylleeafddk
ipeneanefetvgdvvnfikkrkg

SCOPe Domain Coordinates for d2kwla_:

Click to download the PDB-style file with coordinates for d2kwla_.
(The format of our PDB-style files is described here.)

Timeline for d2kwla_: