Lineage for d2kwca_ (2kwc A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178376Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2178398Protein automated matches [190358] (5 species)
    not a true protein
  7. 2178399Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188724] (3 PDB entries)
  8. 2178405Domain d2kwca_: 2kwc A: [242680]
    automated match to d1eo6a_

Details for d2kwca_

PDB Entry: 2kwc (more details)

PDB Description: the nmr structure of the autophagy-related protein atg8
PDB Compounds: (A:) Autophagy-related protein 8

SCOPe Domain Sequences for d2kwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kwca_ d.15.1.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkstfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqf
vyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg

SCOPe Domain Coordinates for d2kwca_:

Click to download the PDB-style file with coordinates for d2kwca_.
(The format of our PDB-style files is described here.)

Timeline for d2kwca_: