SCOPe 2.04: Domain d2kwca_: 2kwc A:

Lineage for d2kwca_ (2kwc A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188724] (3 PDB entries)

8. Domain d2kwca_: 2kwc A: [242680]
   automated match to d1eo6a_

Details for d2kwca_

PDB Entry: 2kwc

PDB Description: the nmr structure of the autophagy-related protein atg8

PDB Compounds: (A:) Autophagy-related protein 8

SCOPe Domain Sequences for d2kwca_:

Sequence; same for both SEQRES and ATOM records:

>d2kwca_ d.15.1.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkstfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqf
vyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg

Timeline for d2kwca_:

• d2kwca_ is new in SCOPe 2.04-stable
  
• d2kwca_ appears in SCOPe 2.05
  
• d2kwca_ appears in the current release, SCOPe 2.08