Lineage for d3btaa1 (3bta A:872-1078)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12782Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 12783Protein Botulinum neurotoxin [49959] (2 species)
  7. 12784Species Clostridium botulinum, serotype A [TaxId:1491] [49960] (1 PDB entry)
  8. 12785Domain d3btaa1: 3bta A:872-1078 [24268]
    Other proteins in same PDB: d3btaa2, d3btaa3, d3btaa4

Details for d3btaa1

PDB Entry: 3bta (more details), 3.2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype a

SCOP Domain Sequences for d3btaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A}
iintsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknai
vynsmyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqe
ikqrvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnn
imfkldgcrdthryiwikyfnlfdkel

SCOP Domain Coordinates for d3btaa1:

Click to download the PDB-style file with coordinates for d3btaa1.
(The format of our PDB-style files is described here.)

Timeline for d3btaa1: