Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins) |
Protein automated matches [254588] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255383] (1 PDB entry) |
Domain d2kvqg_: 2kvq G: [242679] automated match to d1nz9a_ |
PDB Entry: 2kvq (more details)
SCOPe Domain Sequences for d2kvqg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kvqg_ b.34.5.4 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]} rpktlfepgemvrvndgpfadfngvveevdyeksrlkvsvsifgratpveldfsqveka
Timeline for d2kvqg_: