Lineage for d2kvqg_ (2kvq G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2784194Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins)
  6. 2784210Protein automated matches [254588] (1 species)
    not a true protein
  7. 2784211Species Escherichia coli K-12 [TaxId:83333] [255383] (1 PDB entry)
  8. 2784212Domain d2kvqg_: 2kvq G: [242679]
    automated match to d1nz9a_

Details for d2kvqg_

PDB Entry: 2kvq (more details)

PDB Description: solution structure of nuse:nusg-ctd complex
PDB Compounds: (G:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d2kvqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kvqg_ b.34.5.4 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rpktlfepgemvrvndgpfadfngvveevdyeksrlkvsvsifgratpveldfsqveka

SCOPe Domain Coordinates for d2kvqg_:

Click to download the PDB-style file with coordinates for d2kvqg_.
(The format of our PDB-style files is described here.)

Timeline for d2kvqg_: