SCOPe 2.08: Domain d2kvka1: 2kvk A:1-142

Lineage for d2kvka1 (2kvk A:1-142)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.0: automated matches [191561] (1 protein)
   not a true family

6. Protein automated matches [190971] (14 species)
   not a true protein

7. Species Leishmania donovani [TaxId:5661] [255381] (2 PDB entries)

8. Domain d2kvka1: 2kvk A:1-142 [242677]
   Other proteins in same PDB: d2kvka2
   automated match to d4kefa_

Details for d2kvka1

PDB Entry: 2kvk

PDB Description: Solution structure of ADF/cofilin (LDCOF) from Leishmania donovani

PDB Compounds: (A:) Actin severing and dynamics regulatory protein

SCOPe Domain Sequences for d2kvka1:

Sequence; same for both SEQRES and ATOM records:

>d2kvka1 d.109.1.0 (A:1-142) automated matches {Leishmania donovani [TaxId: 5661]}
maisgvtleesvrgaiddlrmkksryvmmcigadgkkievtevgersvnytdlkekfste
kpcyvafdfeyndagskrekliliqwipdtarprekmmysasrdalssvsegylpiqand
esgldaeeiirkvrlhrsvaaa

Timeline for d2kvka1:

• d2kvka1 first appeared in SCOPe 2.04, called d2kvka_
  
• d2kvka1 appears in SCOPe 2.07