Lineage for d2kvaa1 (2kva A:584-725)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416653Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2416654Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2416655Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2416684Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 2416687Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries)
    Uniprot P08169 49-476
  8. 2416703Domain d2kvaa1: 2kva A:584-725 [242675]
    Other proteins in same PDB: d2kvaa2
    automated match to d1e6fa_

Details for d2kvaa1

PDB Entry: 2kva (more details)

PDB Description: solution structure of ci-mpr ligand-free domain 5
PDB Compounds: (A:) cation-independent mannose-6-phosphate receptor

SCOPe Domain Sequences for d2kvaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kvaa1 b.64.1.1 (A:584-725) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
lsrtegdnctvfdsqagfsfdltpltkkdaykvetdkyefhinvcgpvsvgacppdsgac
qvsrsdrkswnlgrsnaklsyydgmiqltyrdgtpynnekrtpratlitflcdrdagvgf
peyqeednstynfrwytsyacp

SCOPe Domain Coordinates for d2kvaa1:

Click to download the PDB-style file with coordinates for d2kvaa1.
(The format of our PDB-style files is described here.)

Timeline for d2kvaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kvaa2