Lineage for d2kvaa_ (2kva A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1801870Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 1801871Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 1801872Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 1801899Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 1801902Species Cow (Bos taurus) [TaxId:9913] [110283] (5 PDB entries)
    Uniprot P08169 49-476
  8. 1801918Domain d2kvaa_: 2kva A: [242675]
    automated match to d1e6fa_

Details for d2kvaa_

PDB Entry: 2kva (more details)

PDB Description: solution structure of ci-mpr ligand-free domain 5
PDB Compounds: (A:) cation-independent mannose-6-phosphate receptor

SCOPe Domain Sequences for d2kvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kvaa_ b.64.1.1 (A:) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Cow (Bos taurus) [TaxId: 9913]}
eaeaeflsrtegdnctvfdsqagfsfdltpltkkdaykvetdkyefhinvcgpvsvgacp
pdsgacqvsrsdrkswnlgrsnaklsyydgmiqltyrdgtpynnekrtpratlitflcdr
dagvgfpeyqeednstynfrwytsyacp

SCOPe Domain Coordinates for d2kvaa_:

Click to download the PDB-style file with coordinates for d2kvaa_.
(The format of our PDB-style files is described here.)

Timeline for d2kvaa_: